PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39463.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 328aa    MW: 37471.8 Da    PI: 4.5424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39463.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
       KHN39463.1 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.23e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
       KHN39463.1  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.533961IPR017930Myb domain
SuperFamilySSF466899.73E-2711108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001672.86E-81661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2464117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.9E-1471111IPR001005SANT/Myb domain
CDDcd001672.11E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLP NATEQTKNQT KQEQQLHHQP VEEEQNQQPL QVDFDPKDDP NKEPETSLES  180
STITEEAILE DQIITPLFDK MELMNGFCTD EVPIIEPDEI LMPCGPSSSS TSSSSSSNST  240
IFLEDLQLPD FEWSCNYNDN STTTHNNNNN NNSSSSSMDL WDEDIIGKLN WLINEDDDSD  300
IENQVFDASL TQFSKMFMDS ESWAYGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0958310.0BT095831.1 Soybean clone JCVI-FLGm-19P8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242827.10.0uncharacterized protein LOC100800494
TrEMBLA0A0B2S4770.0A0A0B2S477_GLYSO; Protein ODORANT1
TrEMBLI1MBV70.0I1MBV7_SOYBN; Uncharacterized protein
STRINGGLYMA14G39530.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-93myb domain protein 20
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]